PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g011169m
Common NameCISIN_1g011169mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Dof
Protein Properties Length: 493aa    MW: 53223.6 Da    PI: 6.2597
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g011169mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1252.4e-3998157261
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                        ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+ 
  orange1.1g011169m  98 PDKIIPCPRCNSMDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKHF 157
                        68999*****************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-3085155IPR003851Zinc finger, Dof-type
PfamPF027019.5E-32100156IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.723102156IPR003851Zinc finger, Dof-type
PROSITE patternPS013610104140IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MNGGDMSAPI KDPAIKLFGA KIPVPDTRIP DVCKQITKEE AEDNHEYNSE EPDKSSSLNN  60
VKEGARNFVQ ANGIQANAKT KADQSESNTD QEKAFKRPDK IIPCPRCNSM DTKFCYFNNY  120
NVNQPRHFCK NCQRYWTAGG TMRNVPVGAG RRKNKHFASQ YRQILVSSDG VPVTGLETPN  180
SANQQLMLCG DSATTFRPST GNGTVLKFGP ETPLCESMEN VLNLRDQKRS VEICTVTCVE  240
NKEEPSSSGS PVTASSIRGN ELPESVMQKE QVMMTGSCNE LNMQQSMHCY PVSPWGVPWN  300
PNNVASMEAA QNPSDRVCVP NGSNPGPVQW CPTTVLAVPG FCAPNIPLQF VPASYWGMGV  360
WAAGAGNIPL TGSNGCLSPS SSTSNNSCCS GNGSPTLGKH SRDPNLTDEG QSEKCVLVPK  420
TLRIDDPDEA SRSPIWATLG FKPDQKDLKS GGAIFKDFET KKGGKADVLD GAEILESNPA  480
ALSRSHTFQE ST*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006443525.10.0hypothetical protein CICLE_v10019872mg
RefseqXP_006479196.10.0PREDICTED: cyclic dof factor 3-like
TrEMBLA0A067FF980.0A0A067FF98_CITSI; Uncharacterized protein
STRINGPOPTR_0013s06290.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM155911017
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.29e-48cycling DOF factor 2